HORDB

ID: hor005878
Uniprot ID: Q6RY98
Protein name: Sarafotoxin-m1
Gene name: NA
Organism: Atractaspis microlepidota microlepidota
Family: Endothelin/sarafotoxin family
Source: Animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Atractaspis microlepidota (species), Atractaspis (genus), Atractaspidinae (subfamily), Lamprophiidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0090729 toxin activity
GO BP: GO:0019229 regulation of vasoconstriction; GO:0035821 modulation of process of another organism; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: CSCNDMNDKECMYFCHQDVIWDEP
Length: 24(78-101)
Propeptide: IWDEPVVVSARDTEEAARVPSPQKRSQPLCSCNDINDKECMYFCHQDVIWDEPVVVSVRDTEEAARVPSPQKRPQPRCSCNDMNDKECMYFCHQDVIWDEPVVVSVRDTEEAARVPSPQKRSQPRCSCNDMNDKECVYFCHLDIIWDEPVVVSVRDTEEATRVPSPQKRSQPLCSCNDINDKECMYFCHQDIIWDEPVVVSVRDTEEAARVPSPQKRSQPLCSCNDINDKECMYFCHQDIIWDEPVVVSVRDTEE
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Vasoconstrictor activity. These toxins cause cardiac arrest probably as a result of coronary vasospasm. The major effects of sarafotoxin-m are a progressive decrease in heart rate (bradycardia) that turns into an arrhythmic phase that is followed by an A-
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005878_AF2.pdb

hor005878_ESM.pdb

Mass:	333670	Formula:	C121H173N31O42S6
Absent amino acids:	AGLRT	Common amino acids:	CD
pI:	3.79	Basic residues:	2
Polar residues:	8	Hydrophobic residues:	4
Hydrophobicity:	-74.58	Boman Index:	-5698
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	28.33
Instability Index:	9102.08	Extinction Coefficient cystines:	7240
Absorbance 280nm:	314.78

PubMed ID: 15350691
Title: Long-sarafotoxins: characterization of a new family of endothelin-like peptides.
PubMed ID: 21889567
Title: Pharmacological and structural characterization of long-sarafotoxins, a new family of endothelin-like peptides: Role of the C-terminus extension.